Iright
BRAND / VENDOR: Proteintech

Proteintech, 83969-6-RR, PRMT3 Recombinant monoclonal antibody

CATALOG NUMBER: 83969-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PRMT3 (83969-6-RR) by Proteintech is a Recombinant antibody targeting PRMT3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83969-6-RR targets PRMT3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, SW480 cells, HEK-293 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PRMT3(protein arginine methyltransferase 3) regulates protein functions by introducing asymmetric dimethylation marks at the arginine residues in proteins. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13466 Product name: Recombinant human PRMT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-531 aa of BC037544 Sequence: RAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ Predict reactive species Full Name: protein arginine methyltransferase 3 Calculated Molecular Weight: 531 aa, 60 kDa Observed Molecular Weight: 60-68 kDa GenBank Accession Number: BC037544 Gene Symbol: PRMT3 Gene ID (NCBI): 10196 RRID: AB_3671545 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924