Iright
BRAND / VENDOR: Proteintech

Proteintech, 83974-2-RR, RNGTT Recombinant monoclonal antibody

CATALOG NUMBER: 83974-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RNGTT (83974-2-RR) by Proteintech is a Recombinant antibody targeting RNGTT in WB, FC (Intra), ELISA applications with reactivity to human samples 83974-2-RR targets RNGTT in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, MCF-7 cells, K-562 cells, HEK-293T cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3105 Product name: Recombinant human RNGTT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-598 aa of BC019954 Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT Predict reactive species Full Name: RNA guanylyltransferase and 5'-phosphatase Calculated Molecular Weight: 597 aa, 69 kDa Observed Molecular Weight: 62-68 kDa GenBank Accession Number: BC019954 Gene Symbol: RNGTT Gene ID (NCBI): 8732 RRID: AB_3671549 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60942 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924