Iright
BRAND / VENDOR: Proteintech

Proteintech, 83993-4-RR, Histone H1.0 Recombinant monoclonal antibody

CATALOG NUMBER: 83993-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Histone H1 83993-4-RR targets Histone H1.0 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. Linker histones are involved in forming higher order structure in chromatin and maintaining overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, unlike some other linker histones. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9982 Product name: Recombinant human Histone H1.0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC000145 Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK Predict reactive species Full Name: H1 histone family, member 0 Calculated Molecular Weight: 21 kDa GenBank Accession Number: BC000145 Gene Symbol: Histone H1.0 Gene ID (NCBI): 3005 RRID: AB_3671569 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P07305 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924