Proteintech, 84012-5-RR, SP100 Recombinant monoclonal antibody

Size: 20ul / 100ul The SP100 (84012-5-RR) by Proteintech is a Recombinant antibody targeting SP100 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84012-5-RR targets SP100 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35193 Product name: Recombinant human SP100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-300 aa of BC011562 Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK Predict reactive species Full Name: SP100 nuclear antigen Calculated Molecular Weight: 879 aa, 100 kDa Observed Molecular Weight: 70-100 kDa, 110-140 kDa GenBank Accession Number: BC011562 Gene Symbol: SP100 Gene ID (NCBI): 6672 RRID: AB_3671580 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P23497 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.