Iright
BRAND / VENDOR: Proteintech

Proteintech, 84017-5-RR, SUMO2/3 Recombinant monoclonal antibody

CATALOG NUMBER: 84017-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SUMO2/3 (84017-5-RR) by Proteintech is a Recombinant antibody targeting SUMO2/3 in IF/ICC, ELISA applications with reactivity to human samples 84017-5-RR targets SUMO2/3 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells, A431 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1135 Product name: Recombinant human SUMO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008420 Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF Predict reactive species Full Name: SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) Calculated Molecular Weight: 12 kDa GenBank Accession Number: BC008420 Gene Symbol: SUMO3 Gene ID (NCBI): 6612 RRID: AB_3671586 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P55854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924