Iright
BRAND / VENDOR: Proteintech

Proteintech, 84032-2-RR, TGM1 Recombinant monoclonal antibody

CATALOG NUMBER: 84032-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TGM1 (84032-2-RR) by Proteintech is a Recombinant antibody targeting TGM1 in WB, IHC, ELISA applications with reactivity to human, rat samples 84032-2-RR targets TGM1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human saliva, rat liver tissue Positive IHC detected in: human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17969 Product name: Recombinant human TGM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 467-817 aa of BC034699 Sequence: SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA Predict reactive species Full Name: transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) Calculated Molecular Weight: 817 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC034699 Gene Symbol: TGM1 Gene ID (NCBI): 7051 RRID: AB_3671599 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924