Iright
BRAND / VENDOR: Proteintech

Proteintech, 84036-6-RR, RIPK1 Recombinant monoclonal antibody

CATALOG NUMBER: 84036-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RIPK1 (84036-6-RR) by Proteintech is a Recombinant antibody targeting RIPK1 in WB, ELISA applications with reactivity to human samples 84036-6-RR targets RIPK1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, Raji cells, HeLa cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RIPK1(Receptor-interacting serine/threonine-protein kinase 1) is primarily involved in mediating TNF-R1-induced cell activation, apoptosis, and necroptosis and belongs to a novel class of kinases that function in cell survival and cell death mechanisms(PMID:22685397 ). It has 2 isoforms produced by alternative splicing. It also can exist as a protein with a lower molecular weight of about 25 kDa and 45 kDa in HAEC and HUVEC(PMID:22685397). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31950 Product name: Recombinant human RIPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 465-671 aa of NM_003804 Sequence: NNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN Predict reactive species Full Name: receptor (TNFRSF)-interacting serine-threonine kinase 1 Calculated Molecular Weight: 76KD Observed Molecular Weight: 70-80 kDa GenBank Accession Number: NM_003804 Gene Symbol: RIPK1 Gene ID (NCBI): 8737 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13546 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924