Iright
BRAND / VENDOR: Proteintech

Proteintech, 84038-3-RR, BCAM Recombinant monoclonal antibody

CATALOG NUMBER: 84038-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BCAM (84038-3-RR) by Proteintech is a Recombinant antibody targeting BCAM in WB, IHC, ELISA applications with reactivity to human samples 84038-3-RR targets BCAM in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, T-47D cells, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28181 Product name: Recombinant human BCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-254 aa of BC050450 Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSP Predict reactive species Full Name: basal cell adhesion molecule (Lutheran blood group) Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa, 78-85 kDa GenBank Accession Number: BC050450 Gene Symbol: BCAM Gene ID (NCBI): 4059 RRID: AB_3671605 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P50895 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924