Iright
BRAND / VENDOR: Proteintech

Proteintech, 84062-3-RR, LRRK2 Recombinant monoclonal antibody

CATALOG NUMBER: 84062-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LRRK2 (84062-3-RR) by Proteintech is a Recombinant antibody targeting LRRK2 in WB, ELISA applications with reactivity to human, mouse, rat samples 84062-3-RR targets LRRK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, RAW 264.7 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Leucine-rich repeat kinase 2 (LRRK2) in humans is encoded by the PARK8/LRRK2 gene. Genetic variations within the LRRK2 gene are linked to a number of diseases, including Parkinson's disease (PD), Crohn's disease and Hansen's disease. The most frequent pathogenic mutations reside in the ROC-COR GTPase (R1441G/C/H, Y1669C) and kinase domains (G2019S, I2020T), indicating important roles for both enzymatic domains in the pathogenicity of LRRK2-driven PD. The G2019S mutation in the Leucine-rich repeat kinase-2 (LRRK2) protein is the most common pathogenic mutation, accounting for 1-6% of sporadic and 3-19% of familial PD. (PMID: 34991886,PMID: 30872638) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33713 Product name: Recombinant human LRRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2372-2527 aa of NM_198578 Sequence: VVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE* Predict reactive species Full Name: leucine-rich repeat kinase 2 Calculated Molecular Weight: 286 kDa Observed Molecular Weight: 286 kDa GenBank Accession Number: NM_198578 Gene Symbol: LRRK2 Gene ID (NCBI): 120892 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5S007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924