Iright
BRAND / VENDOR: Proteintech

Proteintech, 84073-6-RR, EPCAM/CD326 Recombinant monoclonal antibody

CATALOG NUMBER: 84073-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EPCAM/CD326 (84073-6-RR) by Proteintech is a Recombinant antibody targeting EPCAM/CD326 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84073-6-RR targets EPCAM/CD326 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HCT 116 cells, HaCaT cells, MCF-7 cells Positive IHC detected in: human ovary cancer tissue, human colon cancer tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1370 Product name: Recombinant Human EpCAM/CD326 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-265 aa of NM_002354.3 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK Predict reactive species Full Name: epithelial cell adhesion molecule Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: NM_002354.3 Gene Symbol: EPCAM Gene ID (NCBI): 4072 RRID: AB_3671643 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P16422 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924