Iright
BRAND / VENDOR: Proteintech

Proteintech, 84083-2-RR, VGLUT2 Recombinant monoclonal antibody

CATALOG NUMBER: 84083-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The VGLUT2 (84083-2-RR) by Proteintech is a Recombinant antibody targeting VGLUT2 in WB, IHC, IF-Fro, ELISA applications with reactivity to human, mouse samples 84083-2-RR targets VGLUT2 in WB, IHC, IF-Fro, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Background Information VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species Full Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_020346 Gene Symbol: VGLUT2 Gene ID (NCBI): 57084 RRID: AB_3671651 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P2U8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924