Iright
BRAND / VENDOR: Proteintech

Proteintech, 84089-4-RR, TCF1/TCF7 Recombinant monoclonal antibody

CATALOG NUMBER: 84089-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TCF1/TCF7 (84089-4-RR) by Proteintech is a Recombinant antibody targeting TCF1/TCF7 in WB, ELISA applications with reactivity to human, mouse samples 84089-4-RR targets TCF1/TCF7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5792 Product name: Recombinant human TCF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-384 aa of BC048769 Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL Predict reactive species Full Name: transcription factor 7 (T-cell specific, HMG-box) Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC048769 Gene Symbol: TCF1/TCF7 Gene ID (NCBI): 6932 ENSEMBL Gene ID: ENSG00000081059 RRID: AB_3671655 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P36402 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924