Iright
BRAND / VENDOR: Proteintech

Proteintech, 84090-4-RR, MYO9B Recombinant monoclonal antibody

CATALOG NUMBER: 84090-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MYO9B (84090-4-RR) by Proteintech is a Recombinant antibody targeting MYO9B in WB, FC (Intra), ELISA applications with reactivity to human samples 84090-4-RR targets MYO9B in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, Jurkat cells, HL-60 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33349 Product name: Recombinant human MYO9B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1660-1983 aa of BC018108 Sequence: DKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDI Predict reactive species Full Name: myosin IXB Calculated Molecular Weight: 2023 aa, 223 kDa Observed Molecular Weight: 230-250 kDa GenBank Accession Number: BC018108 Gene Symbol: MYO9B Gene ID (NCBI): 4650 RRID: AB_3671656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924