Iright
BRAND / VENDOR: Proteintech

Proteintech, 84103-5-RR, DDX24 Recombinant monoclonal antibody

CATALOG NUMBER: 84103-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DDX24 (84103-5-RR) by Proteintech is a Recombinant antibody targeting DDX24 in WB, ELISA applications with reactivity to human samples 84103-5-RR targets DDX24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, COLO 320 cells, Caco-2 cells, HT-29 cells, THP-1 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DDX24 is a family member of Asp-Glu-Ala-Asp (DEAD) box containing RNA helicases, and DEAD-box RNA helicases are characterized by a conserved DEAD motif. DDX24 was associated with cancer development, viral infection,and vascular malformation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8407 Product name: Recombinant human DDX24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 509-859 aa of BC008847 Sequence: TLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC008847 Gene Symbol: DDX24 Gene ID (NCBI): 57062 RRID: AB_3671668 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9GZR7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924