Iright
BRAND / VENDOR: Proteintech

Proteintech, 84106-3-RR, CCDC134 Recombinant monoclonal antibody

CATALOG NUMBER: 84106-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CCDC134 (84106-3-RR) by Proteintech is a Recombinant antibody targeting CCDC134 in WB, FC (Intra), ELISA applications with reactivity to human samples 84106-3-RR targets CCDC134 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HL-60 cells, U-251 cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21990 Product name: Recombinant human CCDC134 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-229 aa of BC017693 Sequence: TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL Predict reactive species Full Name: coiled-coil domain containing 134 Calculated Molecular Weight: 229 aa, 27 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC017693 Gene Symbol: CCDC134 Gene ID (NCBI): 79879 RRID: AB_3671672 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H6E4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924