Proteintech, 84131-2-RR, EIF3F Recombinant monoclonal antibody

Size: 20ul / 100ul The EIF3F (84131-2-RR) by Proteintech is a Recombinant antibody targeting EIF3F in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84131-2-RR targets EIF3F in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34849 Product name: Recombinant human EIF3F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-357 aa of BC000490 Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit F Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC000490 Gene Symbol: EIF3F Gene ID (NCBI): 8665 RRID: AB_3671689 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00303 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.