Iright
BRAND / VENDOR: Proteintech

Proteintech, 84133-5-RR, CFAP70 Recombinant monoclonal antibody

CATALOG NUMBER: 84133-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CFAP70 (84133-5-RR) by Proteintech is a Recombinant antibody targeting CFAP70 in WB, ELISA applications with reactivity to human samples 84133-5-RR targets CFAP70 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Cilia- and flagella-associated protein 70 (CFAP70), also known as TTC18, harbours eight tetratricopeptide repeats (TPRs) and bound tightly to the ciliary axoneme. CFAP70 is necessary to assemble spermatid flagella and could be used as a diagnostic target for male infertility with OAT in the clinic.CFAP70 is a novel regulatory component of the ODA in motile cilia and flagella, and that the N-terminus is important for its ciliary localization (PMID: 30158508). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35209 Product name: Recombinant human TTC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC032856 Sequence: MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPS Predict reactive species Full Name: tetratricopeptide repeat domain 18 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 110 kDa, 128 kDa GenBank Accession Number: BC032856 Gene Symbol: TTC18 Gene ID (NCBI): 118491 RRID: AB_3671691 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5T0N1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924