Iright
BRAND / VENDOR: Proteintech

Proteintech, 84136-5-RR, IL-1 beta Recombinant monoclonal antibody

CATALOG NUMBER: 84136-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-1 beta (84136-5-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 84136-5-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LPS and Brefeldin A treated THP-1 cells, LPS and Brefeldin A treated RAW 264.7 cells, PMA, LPS and Brefeldin A treated RAW 264.7 cells Positive IF/ICC detected in: LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species Full Name: interleukin 1 beta Calculated Molecular Weight: 31kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_008361.4 Gene Symbol: IL-1 beta Gene ID (NCBI): 16176 RRID: AB_3671695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924