Proteintech, 84150-2-RR, FAM136A Recombinant monoclonal antibody

Size: 20ul / 100ul The FAM136A (84150-2-RR) by Proteintech is a Recombinant antibody targeting FAM136A in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84150-2-RR targets FAM136A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cell, Jurkat cell, MCF-7 cell, U2OS cell, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34058 Product name: Recombinant human FAM136A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC014975 Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK Predict reactive species Full Name: family with sequence similarity 136, member A Observed Molecular Weight: 12 kDa GenBank Accession Number: BC014975 Gene Symbol: FAM136A Gene ID (NCBI): 84908 RRID: AB_3671715 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96C01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.