Proteintech, 84155-6-RR, PPP2CA Recombinant monoclonal antibody

Size: 20ul / 100ul The PPP2CA (84155-6-RR) by Proteintech is a Recombinant antibody targeting PPP2CA in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84155-6-RR targets PPP2CA in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform Calculated Molecular Weight: 309 aa, 36 kDa GenBank Accession Number: BC031696 Gene Symbol: PPP2CA Gene ID (NCBI): 5515 RRID: AB_3671720 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P67775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.