Iright
BRAND / VENDOR: Proteintech

Proteintech, 84167-3-RR, TRMT12 Recombinant monoclonal antibody

CATALOG NUMBER: 84167-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRMT12 (84167-3-RR) by Proteintech is a Recombinant antibody targeting TRMT12 in WB, ELISA applications with reactivity to human samples 84167-3-RR targets TRMT12 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, K-562 cells, U2OS cells, U-521 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9258 Product name: Recombinant human TRMT12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-448 aa of BC011713 Sequence: QGCSPAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLSNIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQALGVSKVEKEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLECCPCPSVG Predict reactive species Full Name: tRNA methyltransferase 12 homolog (S. cerevisiae) Calculated Molecular Weight: 448 aa, 50 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC011713 Gene Symbol: TRMT12 Gene ID (NCBI): 55039 RRID: AB_3671727 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q53H54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924