Proteintech, 84200-1-RR, CDK6 Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK6 (84200-1-RR) by Proteintech is a Recombinant antibody targeting CDK6 in WB, IF/ICC, ELISA applications with reactivity to human samples 84200-1-RR targets CDK6 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, K-562 cells Positive IF/ICC detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5600 Product name: Recombinant human CDK6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-326 aa of BC027989 Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Predict reactive species Full Name: cyclin-dependent kinase 6 Calculated Molecular Weight: 326 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC027989 Gene Symbol: CDK6 Gene ID (NCBI): 1021 RRID: AB_3671756 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q00534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.