Iright
BRAND / VENDOR: Proteintech

Proteintech, 84203-5-RR, KCNJ18 Recombinant monoclonal antibody

CATALOG NUMBER: 84203-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KCNJ18 (84203-5-RR) by Proteintech is a Recombinant antibody targeting KCNJ18 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 84203-5-RR targets KCNJ18 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Mutations in KCNJ18 gene encoding an inwardly rectifying potassium channel (Kir2.6) cause thyrotoxic periodic paralysis (TPP) and sporadic, that is, non-familial cases of HypoPP. Mutant Kir2.6 proteins form a heterotetrameric Kir channel complex with Kir2.1 and thereby reduce cell surface expression of the complex. (PMID: 25882930) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34177 Product name: Recombinant human KCNJ18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 353-433 aa of NM_001194958 Sequence: STPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRGSEI Predict reactive species Full Name: similar to hkir2.2x Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_001194958 Gene Symbol: KCNJ18 Gene ID (NCBI): 100134444 RRID: AB_3671759 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: B7U540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924