Proteintech, 84212-3-RR, CD23 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD23 (84212-3-RR) by Proteintech is a Recombinant antibody targeting CD23 in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 84212-3-RR targets CD23 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse thymus tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD23/Fc ε RII) is a low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21, involved in B cell differentiation and IgE regulation. Two forms of Fc ε RII (Fc ε RIIa and Fc ε RIIb) were found to exist, which differ in structure only in the N-terminal cytoplasmic region, and Fc ε RIIa and Fc ε RIIb play roles in effector cells of B-cell and IgE-mediated immunity, respectively. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, after IgE binding and antigen cross-linking, intracellular killing of parasites is induced by activation of the L-arginine-nitric oxide pathway. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1295 Product name: Recombinant Mouse CD23 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 51-331 aa of EDL21948.1 Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP Predict reactive species Full Name: Fc receptor, IgE, low affinity II, alpha polypeptide Calculated Molecular Weight: 38kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: EDL21948.1 Gene Symbol: Fcer2a Gene ID (NCBI): 14128 RRID: AB_3671769 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20693-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.