Proteintech, 84251-4-RR, COMMD9 Recombinant monoclonal antibody

Size: 20ul / 100ul The COMMD9 (84251-4-RR) by Proteintech is a Recombinant antibody targeting COMMD9 in WB, ELISA applications with reactivity to human samples 84251-4-RR targets COMMD9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, A431 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information COMMD9, also known as HSPC166, is a member of the COMMD family of proteins. The COMMD protein family is an evolutionarily conserved gene family that plays a role in a number of critical biological processes, including inflammation, copper homeostasis, sodium balance, endosomal sorting and cancer. COMMD9 has been shown to participate in TFDP1/E2F1 activation and to play a critical role in non-small cell lung cancer (PMID: 27871936) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35078 Product name: Recombinant human COMMD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC010892 Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK Predict reactive species Full Name: COMM domain containing 9 Observed Molecular Weight: 22 kDa GenBank Accession Number: BC010892 Gene Symbol: COMMD9 Gene ID (NCBI): 29099 RRID: AB_3671800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9P000 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.