Iright
BRAND / VENDOR: Proteintech

Proteintech, 84267-3-RR, TOR1B Recombinant monoclonal antibody

CATALOG NUMBER: 84267-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TOR1B (84267-3-RR) by Proteintech is a Recombinant antibody targeting TOR1B in WB, ELISA applications with reactivity to human samples 84267-3-RR targets TOR1B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Torsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16641 Product name: Recombinant human TOR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-77 aa of BC015578 Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF Predict reactive species Full Name: torsin family 1, member B (torsin B) Calculated Molecular Weight: 336 aa, 38 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC015578 Gene Symbol: TOR1B Gene ID (NCBI): 27348 RRID: AB_3671814 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14657 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924