Iright
BRAND / VENDOR: Proteintech

Proteintech, 84278-5-RR, NME3 Recombinant monoclonal antibody

CATALOG NUMBER: 84278-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NME3 (84278-5-RR) by Proteintech is a Recombinant antibody targeting NME3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 84278-5-RR targets NME3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, K-562 cells Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:500 Background Information NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3), also named as NM23-H3; DR-NM23, is a member of the nucleoside diphosphate kinase (NDPK) family that binds to the mitochondrial outer membrane to stimulate mitochondrial fusion. The depletion of NME3 will cause dysfunction in mitochondrial dynamics. NME3 has been found to facilitate DNA-repair mechanisms binds to several NPHPs, including NEK8, CEP164, and ankyrin repeat and sterile α motif domain-containing 6 (ANKS6) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7284 Product name: Recombinant human NME3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-169 aa of BC000250 Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE Predict reactive species Full Name: non-metastatic cells 3, protein expressed in Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC000250 Gene Symbol: NME3 Gene ID (NCBI): 4832 RRID: AB_3671824 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924