Proteintech, 84287-3-RR, REG Recombinant monoclonal antibody

Size: 20ul / 100ul The REG (84287-3-RR) by Proteintech is a Recombinant antibody targeting REG in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84287-3-RR targets REG in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8640 Product name: Recombinant human REG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC005350 Sequence: MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN Predict reactive species Full Name: regenerating islet-derived 1 alpha Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC005350 Gene Symbol: REG Gene ID (NCBI): 5967 RRID: AB_3671833 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P05451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.