Proteintech, 84289-7-RR, PYROXD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PYROXD1 (84289-7-RR) by Proteintech is a Recombinant antibody targeting PYROXD1 in WB, ELISA applications with reactivity to human samples 84289-7-RR targets PYROXD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U-87 MG cells, Caco-2 cells, COLO 320 cells, PC-3 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information pyridine nucleotide-disulfide oxidoreductase domain 1 (PYROXD1) is a putative oxidoreductase that co-evolved with the tRNA-LC and is essential for its activity in cells and in vivo. PYROXD1 oxidizes NAD(P)H to NAD(P)+ with tightly controlled kinetics, reducing one molecule of O2 into H2O2 per turnover. PYROXD1 is expressed across a range of tissue types in humans, including skeletal muscle, and is conserved across many species. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34768 Product name: Recombinant human PYROXD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-357 aa of BC021662 Sequence: MLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYVELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAG Predict reactive species Full Name: pyridine nucleotide-disulphide oxidoreductase domain 1 Observed Molecular Weight: 55~60 kDa GenBank Accession Number: BC021662 Gene Symbol: PYROXD1 Gene ID (NCBI): 79912 RRID: AB_3671834 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8WU10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.