Iright
BRAND / VENDOR: Proteintech

Proteintech, 84322-4-RR, A1CF Recombinant monoclonal antibody

CATALOG NUMBER: 84322-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The A1CF (84322-4-RR) by Proteintech is a Recombinant antibody targeting A1CF in WB, IHC, ELISA applications with reactivity to human samples 84322-4-RR targets A1CF in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species Full Name: APOBEC1 complementation factor Calculated Molecular Weight: 594 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC054873 Gene Symbol: A1CF Gene ID (NCBI): 29974 RRID: AB_3671864 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NQ94 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924