Proteintech, 84344-2-RR, EPPK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The EPPK1 (84344-2-RR) by Proteintech is a Recombinant antibody targeting EPPK1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84344-2-RR targets EPPK1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Epplakin 1 (EPPK1), belonging to the plakin family, is involved in connecting intermediate filaments and regulating their reorganization in stress response. Studies have shown that EPPK1 is involved in the progression of various cancers, such as liver cancer, cervical cancer, and bladder urothelial carcinoma. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35749 Product name: Recombinant human EPPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1400-1570 aa of NM_031308.3 Sequence: NKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVLEVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEMDSVKRSLEGG Predict reactive species Full Name: epiplakin 1 Calculated Molecular Weight: 555 kDa Observed Molecular Weight: 500-600 kDa GenBank Accession Number: NM_031308.3 Gene Symbol: EPPK1 Gene ID (NCBI): 83481 RRID: AB_3671884 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P58107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.