Proteintech, 84366-5-RR, EPN2 Recombinant monoclonal antibody

Size: 20ul / 100ul The EPN2 (84366-5-RR) by Proteintech is a Recombinant antibody targeting EPN2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 84366-5-RR targets EPN2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, SH-SY5Y cells, HepG2 cells, U2OS cells, PC-3 cells, MDA-MB-231 cells, NIH/3T3 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EPN2 (EPS 15 interacting protein 2) is a protein that interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. EPN2 is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35194 Product name: Recombinant human EPN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 252-448 aa of BC093972 Sequence: LEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSA Predict reactive species Full Name: epsin 2 Calculated Molecular Weight: 584 aa, 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC093972 Gene Symbol: EPN2 Gene ID (NCBI): 22905 RRID: AB_3671902 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.