Iright
BRAND / VENDOR: Proteintech

Proteintech, 84372-5-RR, IKKA Recombinant monoclonal antibody

CATALOG NUMBER: 84372-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IKKA (84372-5-RR) by Proteintech is a Recombinant antibody targeting IKKA in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84372-5-RR targets IKKA in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HCT 116 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NF‐κB is regulated by phosphorylation of one of its cytoplasmic inhibitors, IκB, mediated by IκB kinases (IKK), allowing NF‐κB nuclear translocation and transcriptional activation. IKKα‐IKKβ heterodimer complexes regulate the DNA binding proteins implicated in the canonical NF‐κB pathway, including p50‐p65, while IKKα‐homodimers regulate p52‐RELB dimers implicated in the alternative NF‐κB pathway. (PMID: 34187082) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species Full Name: conserved helix-loop-helix ubiquitous kinase Calculated Molecular Weight: 85 kDa GenBank Accession Number: NM_001278 Gene Symbol: IKK Alpha Gene ID (NCBI): 1147 RRID: AB_3671908 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924