Iright
BRAND / VENDOR: Proteintech

Proteintech, 84374-4-RR, HAPLN1 Recombinant monoclonal antibody

CATALOG NUMBER: 84374-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HAPLN1 (84374-4-RR) by Proteintech is a Recombinant antibody targeting HAPLN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 84374-4-RR targets HAPLN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HAPLN1 (hyaluronan and proteoglycan link protein 1), also known as CRTL1. It is expected to be located in the cytoplasm and extracellular, and the protein is mainly expressed in placenta and small intestine. The calculated molecular weight of HAPLN1 is 40 kDa. HAPLN1 binds to aggrecan on the hyaluronic chain, stabilizing the aggregates and thus increasing compression resistance and shock absorption. HAPLN1 also functions as a growth factor, up regulating aggrecan and type II collagen synthesis in cartilage. It seems to be an essential part of cartilage homeostasis and may also contribute to homeostasis in the disc tissue (PMID: 23537453). It is reported in the literature that it is a double band.(PMID: 26341258) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25221 Product name: Recombinant human HAPLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-131 aa of BC057808 Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTL Predict reactive species Full Name: hyaluronan and proteoglycan link protein 1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC057808 Gene Symbol: HAPLN1 Gene ID (NCBI): 1404 RRID: AB_3671910 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924