Proteintech, 84397-2-RR, PM20D1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PM20D1 (84397-2-RR) by Proteintech is a Recombinant antibody targeting PM20D1 in WB, ELISA applications with reactivity to human, mouse samples 84397-2-RR targets PM20D1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PM20D1 is a secreted enzyme that regulates the endogenous N-fatty acyl amino acid (NAAs) tissue and circulating levels by functioning as a bidirectional NAA synthase/hydrolase (PMID: 27374330). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29154 Product name: Recombinant human PM20D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-202 aa of BC063477 Sequence: TVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGVIYGWGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRIS Predict reactive species Full Name: peptidase M20 domain containing 1 Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC063477 Gene Symbol: PM20D1 Gene ID (NCBI): 148811 RRID: AB_3671928 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6GTS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.