Iright
BRAND / VENDOR: Proteintech

Proteintech, 84398-3-RR, MACROD1 Recombinant monoclonal antibody

CATALOG NUMBER: 84398-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MACROD1 (84398-3-RR) by Proteintech is a Recombinant antibody targeting MACROD1 in WB, ELISA applications with reactivity to human samples 84398-3-RR targets MACROD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information MACRO domain containing 1 (Macrod1) is also named as LRP16. Macrod1 is an ADP-ribosylhydrolase 1 that is highly enriched in mitochondria, participating in the pathogenesis of cardiovascular diseases (PMID: 38459256). MacroD1 was recruited to the sites of DNA damage via recognition of ADP-ribosylation at DNA lesions (PMID: 32683309). MacroD1 is highly expressed in human and mouse skeletal muscle (PMID: 29410655). Macrod1 may play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PMID: 17893710, PMID: 17914104). Macrod1 could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PMID: 17893710). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34080 Product name: Recombinant human MACROD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-166 aa of BC008316 Sequence: AMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV Predict reactive species Full Name: MACRO domain containing 1 Calculated Molecular Weight: 325 aa, 36 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC008316 Gene Symbol: MACROD1 Gene ID (NCBI): 28992 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BQ69 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924