Proteintech, 84399-3-RR, PURG Recombinant monoclonal antibody

Size: 20ul / 100ul The PURG (84399-3-RR) by Proteintech is a Recombinant antibody targeting PURG in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84399-3-RR targets PURG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15820 Product name: Recombinant human PURG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-182 aa of BC106708 Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK Predict reactive species Full Name: purine-rich element binding protein G Calculated Molecular Weight: 347 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC106708 Gene Symbol: PURG Gene ID (NCBI): 29942 RRID: AB_3671929 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UJV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.