Proteintech, 84406-2-RR, CD40 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD40 (84406-2-RR) by Proteintech is a Recombinant antibody targeting CD40 in WB, IF/ICC, ELISA applications with reactivity to human samples 84406-2-RR targets CD40 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Daudi cells, Ramos cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.What is the molecular weight of CD40?The molecular weight of CD40 is 43 kDa.What is the cellular localization of CD40?CD40 can be secreted by cells or found in the cell membrane.What is the tissue specificity of CD40?CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).What is the function of CD40?CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.What is the role of CD40 in disease?Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1797 Product name: Recombinant Human CD40/TNFRSF5 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-193 aa of NM_001250.6 Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR Predict reactive species Full Name: CD40 molecule, TNF receptor superfamily member 5 Calculated Molecular Weight: 31kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_001250.6 Gene Symbol: CD40 Gene ID (NCBI): 958 ENSEMBL Gene ID: ENSG00000101017 RRID: AB_3671936 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25942-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.