Proteintech, 84415-7-RR, IFNGR1/CD119 Recombinant monoclonal antibody

Size: 20ul / 100ul The IFNGR1/CD119 (84415-7-RR) by Proteintech is a Recombinant antibody targeting IFNGR1/CD119 in WB, ELISA applications with reactivity to mouse samples 84415-7-RR targets IFNGR1/CD119 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: CTLL-2 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 (CD119) and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit. Two subunits bind one IFN-γ dimer. Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1536 Product name: Recombinant Mouse IFN-gamma R1/IFNGR1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-254 aa of NM_010511.3 Sequence: ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDS Predict reactive species Full Name: interferon gamma receptor 1 Calculated Molecular Weight: 52kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: NM_010511.3 Gene Symbol: Ifngr1 Gene ID (NCBI): 15979 RRID: AB_3671944 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P15261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.