Iright
BRAND / VENDOR: Proteintech

Proteintech, 84440-5-RR, M-cadherin Recombinant monoclonal antibody

CATALOG NUMBER: 84440-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The M-cadherin (84440-5-RR) by Proteintech is a Recombinant antibody targeting M-cadherin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 84440-5-RR targets M-cadherin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse cerebellum tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Positive IF/ICC detected in: C2C12 cells, H9C2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. M-cadherin (muscle cadherin), also known as CDH15 (cadherin-15), is a 124-kDa type I transmembrane glycoprotein that is highly expressed in developing skeletal muscle, satellite cells, and cerebellum (PMID: 9545347; 12052883). It associates with β-catenin and functions as a cell-cell adhesion molecule in a homophilic and specific manner (PMID: 9545347). M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation (PMID: 1840697). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25763 Product name: Recombinant human CDH15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-450 aa of BC008951 Sequence: AFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR Predict reactive species Full Name: cadherin 15, type 1, M-cadherin (myotubule) Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 90-130 kDa GenBank Accession Number: BC008951 Gene Symbol: M-cadherin Gene ID (NCBI): 1013 RRID: AB_3671966 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P55291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924