Proteintech, 84449-1-RR, Exportin 4 Recombinant monoclonal antibody

Size: 20ul / 100ul The Exportin 4 (84449-1-RR) by Proteintech is a Recombinant antibody targeting Exportin 4 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84449-1-RR targets Exportin 4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, SW480 cells, RAW 264.7 cells Positive IF/ICC detected in: K-562 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:17000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information exportin 4 (XPO4) maps to chromosome 13q and belongs to the importin β family which acts as a bidirectional nuclear transport receptor. Decreased XPO4 expression has been shown to associate with hepatocellular carcinoma. A genome-wide copy number variation (CNV) association study in a small cohort of Malaysian subjects identified a CNV in XPO4 to be correlated with the progression of metabolic (dysfunction) associated fatty liver disease (MAFLD). (PMID: 34388518) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21845 Product name: Recombinant human XPO4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 776-1124 aa of BC113571 Sequence: QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLATRHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEFMANVGGLLCVK Predict reactive species Full Name: exportin 4 Calculated Molecular Weight: 1151 aa, 130 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC113571 Gene Symbol: Exportin 4/XPO4 Gene ID (NCBI): 64328 RRID: AB_3671975 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9C0E2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.