Iright
BRAND / VENDOR: Proteintech

Proteintech, 84454-1-RR, OLFML1 Recombinant monoclonal antibody

CATALOG NUMBER: 84454-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The OLFML1 (84454-1-RR) by Proteintech is a Recombinant antibody targeting OLFML1 in WB, ELISA applications with reactivity to human, mouse, rat samples 84454-1-RR targets OLFML1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, U-251 cells, HuH-7 cells, mouse testis tissue, rat testis tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information OLFML1 (Olfactomedin-like protein 1) is a novel member of human OLF protein family with an olfectamine domain (143-397 aa) in its C-terminus. OLFML1 exhibits the promotion of cell proliferation, along with the increase of percentage of S phase cells. OLFML1 is considered a secreted glycoprotein that enhances cell cycle progression in human cancer cell lines in vitro (PMID: 30266405). OLFML1 contains three potential N-glycosylation sites (residues 66, 138 and 183) and could be modified by the N-glycosylation (PMID: 18708057). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35125 Product name: Recombinant human OLFML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-160 aa of BC092488 Sequence: QRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIVSEDKTLAEMLLQEAEEEKKIRTLLNASCDNMLMGIKSLKIVKKMMDT Predict reactive species Full Name: olfactomedin-like 1 Calculated Molecular Weight: 402 aa, 46 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC092488 Gene Symbol: OLFML1 Gene ID (NCBI): 283298 RRID: AB_3671980 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6UWY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924