Proteintech, 84476-6-RR, ADAMTS2 Recombinant monoclonal antibody

Size: 20ul / 100ul The ADAMTS2 (84476-6-RR) by Proteintech is a Recombinant antibody targeting ADAMTS2 in WB, IF/ICC, ELISA applications with reactivity to human samples 84476-6-RR targets ADAMTS2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, COLO 205 cells, PC-3 cells, HT-1080 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information A disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) is a metalloproteinase that plays a key role in the processing of fibrillar procollagen precursors into mature collagen molecules by excising the amino-propeptide. ADAMTS-2 can, like the procollagen C-proteinases, be regulated by transforming growth factor-β1 (TGF-β1), with implications for mechanisms whereby this growth factor effects net increases in formation of extracellular matrix. Mutations in the ADAMTS-2 gene cause dermatosparaxis in human (dermatosparactic type of Ehlers-Danlos syndrome, also known as Ehlers-Danlos syndrome type VIIC). Human ADAMTS-2 has eight potential sites for Asn-linked glycosylation and other mammals (PMID: 16046392, 12646579). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34957 Product name: Recombinant human ADAMTS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1091-1211 aa of NM_014244 Sequence: KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 2 Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 110~130 kDa GenBank Accession Number: NM_014244 Gene Symbol: ADAMTS2 Gene ID (NCBI): 9509 RRID: AB_3671997 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95450 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.