Iright
BRAND / VENDOR: Proteintech

Proteintech, 84478-6-RR, FKBP11 Recombinant monoclonal antibody

CATALOG NUMBER: 84478-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FKBP11 (84478-6-RR) by Proteintech is a Recombinant antibody targeting FKBP11 in WB, ELISA applications with reactivity to human, mouse, rat samples 84478-6-RR targets FKBP11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FKBP11 (FK506 binding protein 11, also named FKBP19) was first described as predominantly expressed in secretory tissues including the pancreas and recent studies have suggested a role in beta cell survival under conditions of ER stress (PMID: 35456020). In addition, FKBP11 appears to play a role in osteoblasts and bone formation where it has been observed to associate with interferon-inducible transmembrane protein 5 (IFITM5) (PMID: 24058703). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11368 Product name: Recombinant human FKBP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-201 aa of BC027973 Sequence: AEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK Predict reactive species Full Name: FK506 binding protein 11, 19 kDa Calculated Molecular Weight: 201 aa, 22 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC027973 Gene Symbol: FKBP11 Gene ID (NCBI): 51303 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NYL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924