Proteintech, 84484-3-RR, CCDC25 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCDC25 (84484-3-RR) by Proteintech is a Recombinant antibody targeting CCDC25 in WB, ELISA applications with reactivity to human, mouse samples 84484-3-RR targets CCDC25 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, A2780 cells, K-562 cells, MCF-7 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15593 Product name: Recombinant human CCDC25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC032588 Sequence: MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM Predict reactive species Full Name: coiled-coil domain containing 25 Calculated Molecular Weight: 208 aa, 24 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC032588 Gene Symbol: CCDC25 Gene ID (NCBI): 55246 RRID: AB_3672001 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86WR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.