Proteintech, 84490-4-RR, EPCAM/CD326 Recombinant monoclonal antibody

Size: 20ul / 100ul The EPCAM/CD326 (84490-4-RR) by Proteintech is a Recombinant antibody targeting EPCAM/CD326 in WB, ELISA applications with reactivity to mouse, rat samples 84490-4-RR targets EPCAM/CD326 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue, mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg10447 Product name: Recombinant mouse EpCAM protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-266 aa of NM_008532.2 Sequence: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT Predict reactive species Full Name: epithelial cell adhesion molecule Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_008532.2 Gene Symbol: Epcam Gene ID (NCBI): 17075 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99JW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.