Iright
BRAND / VENDOR: Proteintech

Proteintech, 84494-2-RR, EPCR/CD201 Recombinant monoclonal antibody

CATALOG NUMBER: 84494-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EPCR/CD201 (84494-2-RR) by Proteintech is a Recombinant antibody targeting EPCR/CD201 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to mouse samples 84494-2-RR targets EPCR/CD201 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse placenta tissue Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse placenta tissue Positive IF/ICC detected in: bEnd.3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Protein C receptor (PROCR), also known as activated protein C receptor (APC receptor), EPCR, or CD201, is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective impact on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1517 Product name: Recombinant Mouse EPCR/CD201 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-214 aa of NM_011171.2 Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS Predict reactive species Full Name: protein C receptor, endothelial Calculated Molecular Weight: 27kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: NM_011171.2 Gene Symbol: PROCR Gene ID (NCBI): 19124 RRID: AB_3672007 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q64695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924