Proteintech, 84527-5-RR, FADS2 Recombinant monoclonal antibody

Size: 20ul / 100ul The FADS2 (84527-5-RR) by Proteintech is a Recombinant antibody targeting FADS2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84527-5-RR targets FADS2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: U2OS cells, L02 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms and can be detected as 46-52 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species Full Name: fatty acid desaturase 2 Calculated Molecular Weight: 445 aa, 49 kDa GenBank Accession Number: BC009011 Gene Symbol: FADS2 Gene ID (NCBI): 9415 RRID: AB_3672035 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95864 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.