Proteintech, 84547-1-RR, ZMPSTE24 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZMPSTE24 (84547-1-RR) by Proteintech is a Recombinant antibody targeting ZMPSTE24 in WB, ELISA applications with reactivity to human samples 84547-1-RR targets ZMPSTE24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, PC-3 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ZMPSTE24(CAAX prenyl protease 1 homolog) gene encodes a zinc metalloproteinase involved in the processing of farnesylated proteins(PubMed: 10373325). The significance of ZMPSTE24 in human disease stems from its role as an enzyme necessary for the correct processing and maturation of lamin A ,an intermediate filament component of the nuclear envelope (PubMed: 16297189). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33613 Product name: Recombinant human ZMPSTE24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 225-475 aa of BC037283 Sequence: TPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH* Predict reactive species Full Name: zinc metallopeptidase (STE24 homolog, S. cerevisiae) Calculated Molecular Weight: 475 aa, 55 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC037283 Gene Symbol: ZMPSTE24 Gene ID (NCBI): 10269 RRID: AB_3672053 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.