Iright
BRAND / VENDOR: Proteintech

Proteintech, 84568-3-RR, PIGK Recombinant monoclonal antibody

CATALOG NUMBER: 84568-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PIGK (84568-3-RR) by Proteintech is a Recombinant antibody targeting PIGK in WB, ELISA applications with reactivity to human samples 84568-3-RR targets PIGK in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, HeLa cells, HT-1080 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Phosphatidylinositol glycan, class K (PIGK), is a crucial member of the glycosyl-phosphatidylinositol transamidase (GPIT) protein complex that attaches a diverse group of macromolecules to the plasma membrane of eukaryotes. The human PIGK gene is involved in the key step of transferring GPI-anchor to the respective protein molecules in the plasma membrane (PMID: 22824918). Endogenous PIGK has 2 isoforms, 45 kDa and 36 kDa (PMID: 34193731). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3497 Product name: Recombinant human PIGK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC026186 Sequence: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGGIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESRYSS Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class K Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC026186 Gene Symbol: PIGK Gene ID (NCBI): 10026 RRID: AB_3672072 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q92643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924